,
Evolving concepts in the pathogenesis of acne vulgaris, J. Drugs Dermatol, vol.13, p.56, 2014. ,
Inflammation and acne: putting the pieces together, J. Drugs Dermatol, vol.13, pp.459-463, 2014. ,
IL-1beta drives inflammatory responses to propionibacterium acnes in vitro and in vivo, J. Invest. Dermatol, vol.134, pp.677-685, 2014. ,
Propionibacterium acnes Induces IL-1beta secretion via the NLRP3 inflammasome in human monocytes, J. Invest. Dermatol, vol.134, pp.381-388, 2014. ,
Propionibacterium acnes activates the NLRP3 inflammasome in human sebocytes, J. Invest. Dermatol, vol.134, pp.2747-2756, 2014. ,
Inflammasome activation by Propionibacterium acnes: the story of IL-1 in acne continues to unfold, J. Invest. Dermatol, vol.134, pp.595-597, 2014. ,
New insights into acne pathogenesis: propionibacterium acnes activates the inflammasome, J. Invest. Dermatol, vol.134, pp.310-313, 2014. ,
Analysis of gene expression in atopic dermatitis using a microabrasive method, J. Invest. Dermatol, vol.132, pp.469-472, 2012. ,
Universal sample preparation method for proteome analysis, Nat. Methods, vol.6, pp.359-362, 2009. ,
COMPASS: a suite of preand post-search proteomics software tools for OMSSA, Proteomics, vol.11, pp.1064-1074, 2011. ,
STRING v9.1: protein-protein interaction networks, with increased coverage and integration, Nucleic Acids Res, vol.41, pp.808-815, 2013. ,
Computing topological parameters of biological networks, Bioinformatics, vol.24, pp.282-284, 2008. ,
ClueGO: a Cytoscape plug-in to decipher functionally grouped gene ontology and pathway annotation networks, Bioinformatics, vol.25, pp.1091-1093, 2009. ,
Acne is an inflammatory disease and alterations of sebum composition initiate acne lesions, J. Eur. Acad. Dermatol. Venereol, vol.28, pp.527-532, 2014. ,
TNFR2 maintains adequate IL-12 production by dendritic cells in inflammatory responses by regulating endogenous TNF levels, Innate Immun, vol.20, pp.712-720, 2014. ,
Propionibacterium acnes induces an IL-17 response in acne vulgaris that is regulated by vitamin A and vitamin D, J. Invest. Dermatol, vol.134, pp.366-373, 2014. ,
Propionibacterium acnes promotes Th17 and Th17/Th1 responses in acne patients, J. Invest. Dermatol, vol.135, pp.110-118, 2015. ,
Isotretinoin therapy changes the expression of antimicrobial peptides in acne vulgaris, Arch. Dermatol. Res, vol.306, pp.689-700, 2014. ,
Propionibacterium acnes: an update on its role in the pathogenesis of acne, J. Eur. Acad. Dermatol. Venereol, vol.28, pp.271-278, 2014. ,
The secrets of dermcidin action, Int. J. Med. Microbiol, vol.305, pp.283-286, 2015. ,
Cathepsin D is present in human eccrine sweat and involved in the postsecretory processing of the antimicrobial peptide DCD-1L, J. Biol. Chem, vol.281, pp.5406-5415, 2006. ,
Deficiency of dermcidin-derived antimicrobial peptides in sweat of patients with atopic dermatitis correlates with an impaired innate defense of human skin in vivo, J. Immunol, vol.174, pp.8003-8010, 2005. ,
Propionibacterium acnes CAMP factor and host acid sphingomyelinase contribute to bacterial virulence: potential targets for inflammatory acne treatment, PLoS One, vol.6, p.14797, 2011. ,
Regulation of stearoyl-coenzyme A desaturase and fatty acid delta-6 desaturase-2 expression by linoleic acid and arachidonic acid in human sebocytes leads to enhancement of proinflammatory activity but does not affect lipogenesis, Br. J. Dermatol, vol.165, pp.269-276, 2011. ,
Skin microbiome and skin disease: the example of rosacea, J. Clin. Gastroenterol, vol.48, pp.85-86, 2014. ,
The macrophage scavenger receptor type A is expressed by ,
, Localization of the identified peptides by shotgun analyses in MS/MS mode in the sequence of the CAMP factor from P. acnes. b) Multialignment of sequences producing significant alignments for the queried amino acid sequences NTCVLPFK and ATGVLMEPLVRVSEVDQAITDVKAAYQDALKAPNR, showing specificity for P. acnes CAMP factor. activated macrophages and protects the host against lethal endotoxic shock, J. Exp. Med, vol.186, pp.1431-1439, 1997.
Production of superoxide anions by keratinocytes initiates P. acnes-induced inflammation of the skin, PLoS Pathog, vol.5, p.1000527, 2009. ,
Homocysteine, folic acid and vitamin B12 levels in females with severe acne vulgaris, Clin. Chem. Lab. Med, vol.50, pp.2061-2063, 2012. ,
A review of vitamin B12 in dermatology, Am. J. Clin. Dermatol, vol.16, pp.27-33, 2015. ,
Selenium and human health, Lancet, vol.379, pp.1256-1268, 2012. ,
Acne vulgaris: the role of oxidative stress and the potential therapeutic value of local and systemic antioxidants, J. Drugs Dermatol, vol.11, pp.742-746, 2012. ,
Acne vulgaris, mental health and omega-3 fatty acids: a report of cases, Lipids Health Dis, vol.7, p.36, 2008. ,
Proteome analysis of human sebaceous follicle infundibula extracted from healthy and acneaffected skin, PLoS One, vol.9, p.107908, 2014. ,